PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB08G15090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HB-other
Protein Properties Length: 215aa    MW: 24287.8 Da    PI: 6.2818
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB08G15090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.43.8e-21108164157
                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                   +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  OB08G15090.1 108 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 164
                   678899************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2389149IPR009057Homeodomain-like
SuperFamilySSF466895.85E-2194165IPR009057Homeodomain-like
PROSITE profilePS5007117.07105165IPR001356Homeobox domain
SMARTSM003892.3E-20106169IPR001356Homeobox domain
PfamPF000469.3E-19108163IPR001356Homeobox domain
CDDcd000866.49E-20108166No hitNo description
PRINTSPR000314.3E-5136145IPR000047Helix-turn-helix motif
PROSITE patternPS000270140163IPR017970Homeobox, conserved site
PRINTSPR000314.3E-5145161IPR000047Helix-turn-helix motif
Gene3DG3DSA:1.10.10.602.4E-4150192IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MTPARRMPPV IGRNGVAYGS PSAQLPLTQT DLLDSHHLQQ ALQQQYFDQI PVTTTTAPAD  60
SGDNMLHGRA DAGGLGDEFE SKSCSENVDG AGDGLSGDDQ DPNQRPRKKR YHRHTQHQIQ  120
EMEAFFKECP HPDDKQRKEL SRELGLEPLQ VKFWFQNKRT QMKNQHERHE NAQLRAENDK  180
LRAENMRYKE ALSSASCPNC GGPDALGEMS FDEHH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0779930.0AB077993.1 Oryza sativa mRNA for Roc1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006659894.11e-156PREDICTED: homeobox-leucine zipper protein ROC1
SwissprotQ6ZAR01e-142ROC1_ORYSJ; Homeobox-leucine zipper protein ROC1
TrEMBLJ3MQY01e-162J3MQY0_ORYBR; Uncharacterized protein
STRINGOB08G15090.11e-162(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2665955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G05230.47e-71homeodomain GLABROUS 2